PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004501636.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 27055.4 Da    PI: 9.4161
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004501636.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.53.6e-281262151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+i++k+ rqvtfskRr+g++KKAeELSvLCdaev +i+fsstgkl++y+s
  XP_004501636.1 12 KKIDDKTARQVTFSKRRKGLFKKAEELSVLCDAEVGLIVFSSTGKLFDYCS 62
                    68***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-38463IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.38464IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.76E-31675IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-26626IPR002100Transcription factor, MADS-box
PROSITE patternPS003500660IPR002100Transcription factor, MADS-box
PfamPF003193.6E-261360IPR002100Transcription factor, MADS-box
CDDcd002654.13E-311972No hitNo description
PRINTSPR004042.5E-262641IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-264162IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.18289179IPR002487Transcription factor, K-box
PfamPF014863.8E-1394173IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MMKMKRKKIT IKKIDDKTAR QVTFSKRRKG LFKKAEELSV LCDAEVGLIV FSSTGKLFDY  60
CSTSMKDTIT RYNAQDHGIN KLNTPSQELQ LEASNRIKLD KEIADRTQQL KQMKGDDIEA  120
LNLNELQLLE KTLHIGFNRV IETKEKRIMS EISDLQKMET VLKEENKLLK HKVEVRQMIS  180
MMSKTRCPSL IDSKIGIQEE RVSLDSISCA SDPLFEDDYS DTSLKLGLPF SNRRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A1e-19674270Myocyte-specific enhancer factor 2A
3mu6_B1e-19674270Myocyte-specific enhancer factor 2A
3mu6_C1e-19674270Myocyte-specific enhancer factor 2A
3mu6_D1e-19674270Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004501636.11e-171PREDICTED: MADS-box protein AGL24-like isoform X3
SwissprotQ9FVC13e-70SVP_ARATH; MADS-box protein SVP
TrEMBLA0A0B2PN637e-98A0A0B2PN63_GLYSO; MADS-box protein SVP
TrEMBLC6T8M27e-98C6T8M2_SOYBN; Uncharacterized protein
STRINGGLYMA06G10020.22e-97(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.12e-58MIKC_MADS family protein